SCOPe 2.06: Domain d4pzea2: 4pze A:186-284

Lineage for d4pzea2 (4pze A:186-284)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)

Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true family
Protein automated matches [226851] (35 species)
not a true protein
Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries)
Domain d4pzea2: 4pze A:186-284 [271669]
Other proteins in same PDB: d4pzea1, d4pzeb1, d4pzec1, d4pzed1, d4pzee1, d4pzef1, d4pzeg1, d4pzeh1, d4pzei1
automated match to d4kuga2
complexed with caa

Details for d4pzea2

PDB Entry: 4pze (more details), 2.7 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa

PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzea2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

SCOPe Domain Coordinates for d4pzea2:

Click to download the PDB-style file with coordinates for d4pzea2.
(The format of our PDB-style files is described here.)

Timeline for d4pzea2: