Lineage for d4pwza1 (4pwz A:23-161)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1604003Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 1604017Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 1604018Protein automated matches [232576] (2 species)
    not a true protein
  7. 1604025Species Yersinia pestis [TaxId:214092] [256379] (2 PDB entries)
  8. 1604026Domain d4pwza1: 4pwz A:23-161 [254099]
    Other proteins in same PDB: d4pwza2, d4pwzb2
    automated match to d2ivza2
    complexed with gol, mes, peg, so4

Details for d4pwza1

PDB Entry: 4pwz (more details), 1.73 Å

PDB Description: Crystal structure of TolB protein from Yersinia pestis CO92
PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d4pwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwza1 c.51.2.0 (A:23-161) automated matches {Yersinia pestis [TaxId: 214092]}
vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
ysahtvsdevfekltgikg

SCOPe Domain Coordinates for d4pwza1:

Click to download the PDB-style file with coordinates for d4pwza1.
(The format of our PDB-style files is described here.)

Timeline for d4pwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pwza2