Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
Protein automated matches [190318] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries) |
Domain d4pwta_: 4pwt A: [238504] automated match to d1oapa_ complexed with fmt, pop, so4 |
PDB Entry: 4pwt (more details), 1.75 Å
SCOPe Domain Sequences for d4pwta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwta_ d.79.7.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]} natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf aknrravlvy
Timeline for d4pwta_: