Lineage for d4pt1b_ (4pt1 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. Protein automated matches [191085] (10 species)
    not a true protein
  7. Species Migratory locust (Locusta migratoria) [TaxId:7004] [268576] (1 PDB entry)
  8. Domain d4pt1b_: 4pt1 B: [268577]
    automated match to d3k1eb_
    complexed with pg0

Details for d4pt1b_

PDB Entry: 4pt1 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of locusta migratoria odorant binding proteins lmigobp1
PDB Compounds: (B:) Odorant-binding protein 1d

SCOPe Domain Sequences for d4pt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pt1b_ a.39.2.0 (B:) automated matches {Migratory locust (Locusta migratoria) [TaxId: 7004]}
nmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefnslsd
dgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelyslvvr
afdatigd

SCOPe Domain Coordinates for d4pt1b_ are not available.

Timeline for d4pt1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4pt1a_