Lineage for d4prsb_ (4prs B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (140 species)
not a true protein
Species Thermotoga maritima [TaxId:243274] [187721] (5 PDB entries) 
Domain d4prsb_: 4prs B: [258231]
automated match to d3vv5a_
Details for d4prsb_
PDB Entry: 4prs (more details), 1.47 Å
PDB Description: Structure of apo ArgBP from T. maritima
PDB Compounds: (B:) ABC-type transporter, periplasmic subunit family 3SCOPe Domain Sequences for d4prsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prsb_ c.94.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
aideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgl
ipslltkkidviisgmtiteerkkvvafsdpyfdagqvivvrkdsdfrpktyedlvgktv
avqigttgdievskydgikvvrfdkftdaflelkrgradavvldsatarafvaknpdlvi
ssgvlsseqygiavrkedtdllefinsvlrelkkspydvliekwfse
SCOPe Domain Coordinates for d4prsb_:
Click to download the PDB-style file with coordinates for d4prsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4prsb_:
- d4prsb_ first appeared in SCOPe 2.04
- d4prsb_ appears in SCOPe 2.05
- d4prsb_ appears in SCOPe 2.07
- d4prsb_ appears in the current release, SCOPe 2.08
View in 3D
