Lineage for d4pq7a_ (4pq7 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1804999Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1805000Protein Carbonic anhydrase [51071] (10 species)
  7. 1805038Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (555 PDB entries)
    Uniprot P00918
  8. 1805459Domain d4pq7a_: 4pq7 A: [260228]
    automated match to d2foua_
    complexed with gol, il3, zn

Details for d4pq7a_

PDB Entry: 4pq7 (more details), 1.85 Å

PDB Description: The crystal structure of the human carbonic anhydrase ii in complex with a sulfamide inhibitor
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4pq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pq7a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
gmshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslri
lnnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelh
lvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfd
prgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeel
mvdnwrpaqplknrqikasf

SCOPe Domain Coordinates for d4pq7a_:

Click to download the PDB-style file with coordinates for d4pq7a_.
(The format of our PDB-style files is described here.)

Timeline for d4pq7a_: