Lineage for d4ppua_ (4ppu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. Protein automated matches [237402] (7 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346214] (2 PDB entries)
  8. Domain d4ppua_: 4ppu A: [345406]
    automated match to d5w6yb_
    complexed with tyr

Details for d4ppua_

PDB Entry: 4ppu (more details), 2.3 Å

PDB Description: Crystal Structure of AtCM1 with Tyrosine Bound in Allosteric Site
PDB Compounds: (A:) Chorismate mutase 1, chloroplastic

SCOPe Domain Sequences for d4ppua_:

Sequence, based on SEQRES records: (download)

>d4ppua_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv
kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd
lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd
almdmltfptvedaikkrvemktrtygqevkvgmeekeeeeeegneshvykispilvgdl
ygdwimpltkevqveyllrrld

Sequence, based on observed residues (ATOM records): (download)

>d4ppua_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv
kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd
lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd
almdmltfptvedaikkrvemktrtygqevkvykispilvgdlygdwimpltkevqveyl
lrrld

SCOPe Domain Coordinates for d4ppua_ are not available.

Timeline for d4ppua_: