Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries) |
Domain d4pmub_: 4pmu B: [260364] automated match to d4k68a_ |
PDB Entry: 4pmu (more details), 2.86 Å
SCOPe Domain Sequences for d4pmub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pmub_ c.1.8.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]} tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsat
Timeline for d4pmub_: