Class a: All alpha proteins [46456] (290 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.0: automated matches [227254] (1 protein) not a true family |
Protein automated matches [227039] (3 species) not a true protein |
Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries) |
Domain d4ph0a1: 4ph0 A:1-126 [273640] Other proteins in same PDB: d4ph0a2, d4ph0b2, d4ph0c2, d4ph0d2, d4ph0e2, d4ph0f2 automated match to d1qrja2 |
PDB Entry: 4ph0 (more details), 2.75 Å
SCOPe Domain Sequences for d4ph0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ph0a1 a.73.1.0 (A:1-126) automated matches {Bovine leukemia virus [TaxId: 11901]} piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa wknlpt
Timeline for d4ph0a1: