Lineage for d4ph0a1 (4ph0 A:1-126)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2718058Family a.73.1.0: automated matches [227254] (1 protein)
    not a true family
  6. 2718059Protein automated matches [227039] (3 species)
    not a true protein
  7. 2718060Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries)
  8. 2718065Domain d4ph0a1: 4ph0 A:1-126 [273640]
    Other proteins in same PDB: d4ph0a2, d4ph0b2, d4ph0c2, d4ph0d2, d4ph0e2, d4ph0f2
    automated match to d1qrja2

Details for d4ph0a1

PDB Entry: 4ph0 (more details), 2.75 Å

PDB Description: capsid protein from bovine leukemia virus
PDB Compounds: (A:) BLV capsid

SCOPe Domain Sequences for d4ph0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ph0a1 a.73.1.0 (A:1-126) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlpt

SCOPe Domain Coordinates for d4ph0a1:

Click to download the PDB-style file with coordinates for d4ph0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ph0a1: