Lineage for d4pdha_ (4pdh A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Polaromonas sp. [TaxId:296591] [257484] (2 PDB entries)
  8. Domain d4pdha_: 4pdh A: [257486]
    automated match to d4ovsa_
    complexed with eax

Details for d4pdha_

PDB Entry: 4pdh (more details), 1.8 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4pdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pdha_ c.94.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}
ettmkisistsqnshqgvaidtfakevekrtggrykvqtfysgalggeresieavqlgtq
elafsstgpvpnfvpetkildvpflfrdkaharavldgpigqdllgkfdakgfkalawge
ngfrhmtnskrdvkgpedlkglkmrtmenpvhiaaykgfgiittpmafpevftalqqgtv
dgqenplsviiaskfdqvqkhlsltghvyspciwvmnkavfdklsaadkqafldaakegt
kanrarvdeddakgvadlrakgmtvidnidkskfvtalapvnaefekqfgkaniekirny
k

SCOPe Domain Coordinates for d4pdha_ are not available.

Timeline for d4pdha_: