Lineage for d4p9ka_ (4p9k A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164396Species Verminephrobacter eiseniae [TaxId:391735] [257451] (2 PDB entries)
  8. 2164398Domain d4p9ka_: 4p9k A: [257452]
    automated match to d4ovsa_
    complexed with eax

Details for d4p9ka_

PDB Entry: 4p9k (more details), 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand.
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4p9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p9ka_ c.94.1.0 (A:) automated matches {Verminephrobacter eiseniae [TaxId: 391735]}
aaqttmrinistaqnshqgvaidtfakevekrtggrykvqtfynaalgaeresveavqlg
theltfsssgpipnfvpetkildvpflfrdkaharavldgpigqelltrfdgkgfkalaw
aengfrhmsnskravkepgdlkglkmrtmenpvhiaaykgfgivttpmafsevftalqqg
tvdgqenplsviisakfdqvqkhltltghvyspalflmnkalfdklpaadqqafidaarq
gaklnrarvdeddakgvadlrakgmtvidnidkarfvaalapvnaqfekqfgkaaleqir
saq

SCOPe Domain Coordinates for d4p9ka_:

Click to download the PDB-style file with coordinates for d4p9ka_.
(The format of our PDB-style files is described here.)

Timeline for d4p9ka_: