Lineage for d4p5ob_ (4p5o B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642224Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2642257Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 2642258Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 2642266Domain d4p5ob_: 4p5o B: [258094]
    Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5oc1, d4p5oc2, d4p5og1, d4p5og2, d4p5og3, d4p5oh_, d4p5oi1, d4p5oi2, d4p5oi3, d4p5ok_
    automated match to d3dplr_
    complexed with zn

Details for d4p5ob_

PDB Entry: 4p5o (more details), 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action
PDB Compounds: (B:) E3 ubiquitin-protein ligase RBX1

SCOPe Domain Sequences for d4p5ob_:

Sequence, based on SEQRES records: (download)

>d4p5ob_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
evkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhafhfh
cisrwlktrqvcpldnrewefq

Sequence, based on observed residues (ATOM records): (download)

>d4p5ob_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
evkkwnavalwawdivvdncaicrnhimdlciecqanectvawgvcnhafhfhcisrwlk
trqvcpldnrewefq

SCOPe Domain Coordinates for d4p5ob_:

Click to download the PDB-style file with coordinates for d4p5ob_.
(The format of our PDB-style files is described here.)

Timeline for d4p5ob_: