Lineage for d4p56b_ (4p56 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163530Species Bordetella bronchiseptica [TaxId:257310] [267969] (3 PDB entries)
  8. 2163536Domain d4p56b_: 4p56 B: [269259]
    automated match to d4napb_
    complexed with pge, rmn, smn

Details for d4p56b_

PDB Entry: 4p56 (more details), 1.9 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate
PDB Compounds: (B:) Putative extracellular solute-binding protein

SCOPe Domain Sequences for d4p56b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p56b_ c.94.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
pveltlsswlppthavvadflmpwgeeirkatdgrvtlrllpkavtnpaghfdavrdglv
dvtfvshayypgrfqltkfavlpfsgdtatsrsiaawdtyekyllkadehkgvrllgiya
hgpgiafttskpvkqigdfqglkirvgggmaadvakavgaspiakpapesyellstgvad
gvffpaeslvsfkldsiirhatefpgglysdthaviinrdafarlskqdqdtlvrlsgrh
laelagrawdthdaaarkvleggeielvkaddalieavrertkgfeqawldaakakgidg
paalasfraeikqldqq

SCOPe Domain Coordinates for d4p56b_:

Click to download the PDB-style file with coordinates for d4p56b_.
(The format of our PDB-style files is described here.)

Timeline for d4p56b_: