Lineage for d4p47a_ (4p47 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880801Species Ochrobactrum anthropi [TaxId:439375] [257422] (2 PDB entries)
  8. 1880802Domain d4p47a_: 4p47 A: [257423]
    automated match to d4n6ka_

Details for d4p47a_

PDB Entry: 4p47 (more details), 1.3 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4p47a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p47a_ c.94.1.0 (A:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
eirsqtikfaaanskghpqvtgmekfaelvkeksggqinvklfpggvlgsdpqtlsglqg
gvvemtvmnagilsstvkafeavdlpflfnsgeeadkvmdgpfgtnlmkrlpdtgligla
ywelgfrnltnnrhpvaklediaglkirtlqspvpvalfnalganavplpytelytalet
gtvdgqenpnaniinakfyevqkyltltrhqynpqivmiskkfwdrlndeekavieqaav
eardyqrkvsreqdataldeikktgmqvteltpeettrlrdavkpiidkftaeigaetvd
elfaelkkvrgenaenlyfq

SCOPe Domain Coordinates for d4p47a_:

Click to download the PDB-style file with coordinates for d4p47a_.
(The format of our PDB-style files is described here.)

Timeline for d4p47a_: