![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.149.1: RNase III domain-like [69065] (3 families) ![]() |
![]() | Family a.149.1.0: automated matches [275200] (1 protein) not a true family |
![]() | Protein automated matches [275201] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [275202] (2 PDB entries) |
![]() | Domain d4ouna_: 4oun A: [275203] automated match to d1u61a_ |
PDB Entry: 4oun (more details), 1.8 Å
SCOPe Domain Sequences for d4ouna_:
Sequence, based on SEQRES records: (download)
>d4ouna_ a.149.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} fdtikdskqlnglalayigdaifevyvrhhllkqgftkpndlhkkssrivsaksqaeilf flqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafqallgylflekkeerlsq lvaeaiqfgts
>d4ouna_ a.149.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} fdtikdskqlnglalayigdaifevyvrhhllkqgftkpndlhkkssrivsaksqaeilf flqnqsffteeeeavlkrgrnakntdvqtyrystafqallgylflekkeerlsqlvaeai qfgts
Timeline for d4ouna_: