Lineage for d4ouna_ (4oun A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735030Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2735031Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2735077Family a.149.1.0: automated matches [275200] (1 protein)
    not a true family
  6. 2735078Protein automated matches [275201] (1 species)
    not a true protein
  7. 2735079Species Bacillus subtilis [TaxId:224308] [275202] (2 PDB entries)
  8. 2735080Domain d4ouna_: 4oun A: [275203]
    automated match to d1u61a_

Details for d4ouna_

PDB Entry: 4oun (more details), 1.8 Å

PDB Description: crystal structure of mini-ribonuclease 3 from bacillus subtilis
PDB Compounds: (A:) Mini-ribonuclease 3

SCOPe Domain Sequences for d4ouna_:

Sequence, based on SEQRES records: (download)

>d4ouna_ a.149.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
fdtikdskqlnglalayigdaifevyvrhhllkqgftkpndlhkkssrivsaksqaeilf
flqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafqallgylflekkeerlsq
lvaeaiqfgts

Sequence, based on observed residues (ATOM records): (download)

>d4ouna_ a.149.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
fdtikdskqlnglalayigdaifevyvrhhllkqgftkpndlhkkssrivsaksqaeilf
flqnqsffteeeeavlkrgrnakntdvqtyrystafqallgylflekkeerlsqlvaeai
qfgts

SCOPe Domain Coordinates for d4ouna_:

Click to download the PDB-style file with coordinates for d4ouna_.
(The format of our PDB-style files is described here.)

Timeline for d4ouna_: