Lineage for d4oteb_ (4ote B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915414Species Clostridium difficile [TaxId:272563] [197037] (2 PDB entries)
  8. 2915416Domain d4oteb_: 4ote B: [237886]
    automated match to d4ef1b_
    complexed with act, cl, gol, mse, zn

Details for d4oteb_

PDB Entry: 4ote (more details), 2.2 Å

PDB Description: crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
PDB Compounds: (B:) Lipoprotein

SCOPe Domain Sequences for d4oteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oteb_ c.94.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]}
kddkkivvgatlvpggelleelkplikekgytlevknfddyilpnealnngeidanlfqh
epylkeavkakgykimagkklyvcpailysykiksvdefkkgdtiaisnnpsscsknlry
lesiglltlpkgdglvspkdiienpkgiqfkeldiaqipsslpdvtaafidttyavpagl
dakkngiytapindeyanllafrtedkdsekikvlqdvltsdkarslieekykgiviptf

SCOPe Domain Coordinates for d4oteb_:

Click to download the PDB-style file with coordinates for d4oteb_.
(The format of our PDB-style files is described here.)

Timeline for d4oteb_: