Lineage for d4oqoa_ (4oqo A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (4 proteins)
further duplication: composed of two two-domain lobes
Protein Lactoferrin [53889] (6 species) Species Cow (Bos taurus) [TaxId:9913] [53891] (20 PDB entries) 
Domain d4oqoa_: 4oqo A: [237718]
automated match to d2q8ja_
complexed with nag
Details for d4oqoa_
PDB Entry: 4oqo (more details), 2.42 Å
PDB Description: crystal structure of the tryptic generated iron-free c-lobe of bovine lactoferrin at 2.42 angstrom resolution
PDB Compounds: (A:) lactotransferrinSCOPe Domain Sequences for d4oqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oqoa_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr
SCOPe Domain Coordinates for d4oqoa_:
Click to download the PDB-style file with coordinates for d4oqoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oqoa_:
- d4oqoa_ first appeared in SCOPe 2.03
- d4oqoa_ appears in SCOPe 2.07
View in 3D
