Lineage for d4oozb_ (4ooz B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (72 species)
not a true protein
Species Cryptopygus antarcticus [TaxId:187623] [258696] (2 PDB entries) 
Domain d4oozb_: 4ooz B: [258698]
automated match to d2c0ha1
complexed with bma
Details for d4oozb_
PDB Entry: 4ooz (more details), 2.6 Å
PDB Description: crystal structure of beta-1,4-d-mannanase from cryptopygus antarcticus in complex with mannopentaose
PDB Compounds: (B:) beta-1,4-mannanaseSCOPe Domain Sequences for d4oozb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oozb_ c.1.8.0 (B:) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
seflkasgsnfyyggqkvflsgvnfawrsygsdfgngqyasngpalkdwinkvkasggnt
arvwvhvegqvspafdshgfvtstdskktlindlsdlldyangqnvflilvlfngalqnn
snvqnlfwdesklnsyinnaltpmvnalkskpslaawevlnepegtlqpgsdqnscydts
tlaaqgagwggkkfpmkqilktinwissaihnadskalvtvgswseltqtdsfgyrnhyk
dscltgaggksngiinfyqmhtyshsgkwnqnapfkvnrwaynvndkplligefasvcsq
negiqnlykyaynngyngaltwqfnsggdcsdtysnqmygmqalkgqndqsggkggmvsv
ninhh
SCOPe Domain Coordinates for d4oozb_:
Click to download the PDB-style file with coordinates for d4oozb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oozb_:
- d4oozb_ first appeared in SCOPe 2.04
- d4oozb_ is called d4oozb1 in SCOPe 2.06
- d4oozb_ appears in the current release, SCOPe 2.08, called d4oozb1
View in 3D
