Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Cryptopygus antarcticus [TaxId:187623] [258696] (2 PDB entries) |
Domain d4oozb_: 4ooz B: [258698] automated match to d2c0ha1 complexed with bma |
PDB Entry: 4ooz (more details), 2.6 Å
SCOPe Domain Sequences for d4oozb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oozb_ c.1.8.0 (B:) automated matches {Cryptopygus antarcticus [TaxId: 187623]} seflkasgsnfyyggqkvflsgvnfawrsygsdfgngqyasngpalkdwinkvkasggnt arvwvhvegqvspafdshgfvtstdskktlindlsdlldyangqnvflilvlfngalqnn snvqnlfwdesklnsyinnaltpmvnalkskpslaawevlnepegtlqpgsdqnscydts tlaaqgagwggkkfpmkqilktinwissaihnadskalvtvgswseltqtdsfgyrnhyk dscltgaggksngiinfyqmhtyshsgkwnqnapfkvnrwaynvndkplligefasvcsq negiqnlykyaynngyngaltwqfnsggdcsdtysnqmygmqalkgqndqsggkggmvsv ninhh
Timeline for d4oozb_: