Lineage for d4oltb_ (4olt B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926431Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 2926440Protein automated matches [230243] (3 species)
    not a true protein
  7. 2926444Species Pseudomonas sp. [TaxId:878476] [257287] (1 PDB entry)
  8. 2926446Domain d4oltb_: 4olt B: [257289]
    automated match to d1chka_
    complexed with gol

Details for d4oltb_

PDB Entry: 4olt (more details), 1.59 Å

PDB Description: chitosanase complex structure
PDB Compounds: (B:) Chitosanase

SCOPe Domain Sequences for d4oltb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oltb_ d.2.1.7 (B:) automated matches {Pseudomonas sp. [TaxId: 878476]}
gtvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggligftsgtgdmle
lvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdr
vyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdet
eyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln

SCOPe Domain Coordinates for d4oltb_:

Click to download the PDB-style file with coordinates for d4oltb_.
(The format of our PDB-style files is described here.)

Timeline for d4oltb_: