Lineage for d4oitb_ (4oit B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806095Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 1806096Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 1806148Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 1806149Protein automated matches [190587] (7 species)
    not a true protein
  7. 1806176Species Mycobacterium smegmatis [TaxId:246196] [258042] (2 PDB entries)
  8. 1806178Domain d4oitb_: 4oit B: [258043]
    automated match to d2d04f_
    complexed with bma, man

Details for d4oitb_

PDB Entry: 4oit (more details), 2.24 Å

PDB Description: structure, interactions and evolutionary implications of a domain- swapped lectin dimer from mycobacterium smegmatis
PDB Compounds: (B:) LysM domain protein

SCOPe Domain Sequences for d4oitb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oitb_ b.78.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd
gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsleh

SCOPe Domain Coordinates for d4oitb_:

Click to download the PDB-style file with coordinates for d4oitb_.
(The format of our PDB-style files is described here.)

Timeline for d4oitb_: