Lineage for d4ohna_ (4ohn A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:637987] [193477] (7 PDB entries)
  8. Domain d4ohna_: 4ohn A: [268517]
    automated match to d3hv1a_
    complexed with act, his

Details for d4ohna_

PDB Entry: 4ohn (more details), 1.37 Å

PDB Description: Crystal structure of an ABC uptake transporter substrate binding protein from Streptococcus pneumoniae with Bound Histidine
PDB Compounds: (A:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4ohna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohna_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
tsgdnwskyqsnksitigfdstfvpmgfaqkdgsyagfdidlatavfekygitvnwqpid
wdlkeaeltkgtidliwngysatderrekvafsnsymkneqvlvtkkssgittakdmtgk
tlgaqagssgyadfeanpeilknivankeanqyqtfnealidlkndridgllidrvyany
yleaegvlndynvftvgleteafavgsrkedttlvkkineafsslykdgkfqeisqkwfg
edvatk

SCOPe Domain Coordinates for d4ohna_ are not available.

Timeline for d4ohna_: