Lineage for d4ogya_ (4ogy A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066303Domain d4ogya_: 4ogy A: [259412]
    Other proteins in same PDB: d4ogyl1, d4ogyl2, d4ogyn1, d4ogyn2
    automated match to d2anya_
    complexed with edo

Details for d4ogya_

PDB Entry: 4ogy (more details), 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution
PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d4ogya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogya_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqssd

SCOPe Domain Coordinates for d4ogya_:

Click to download the PDB-style file with coordinates for d4ogya_.
(The format of our PDB-style files is described here.)

Timeline for d4ogya_: