Lineage for d4oggb1 (4ogg B:3-190)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. Protein automated matches [190197] (23 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries)
  8. Domain d4oggb1: 4ogg B:3-190 [307887]
    Other proteins in same PDB: d4oggb3, d4oggc3
    automated match to d3uk7a1

Details for d4oggb1

PDB Entry: 4ogg (more details), 1.6 Å

PDB Description: Crystal Structure of Arabidopsis thaliana DJ-1d with glyoxylate as substrate analog
PDB Compounds: (B:) Protein DJ-1 homolog D

SCOPe Domain Sequences for d4oggb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oggb1 c.23.16.0 (B:3-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nsrtvlilcgdymedyevmvpfqalqafgitvhtvcpgkkagdscptavhdfcghqtyfe
srghnftlnatfdevdlskydglvipggrapeylaltasvvelvkefsrsgkpiasixhg
qlilaaadtvngrkctayatvgpslvaagakwvepitpdvcvvdgslitaatyeghpefi
qlfvkalg

SCOPe Domain Coordinates for d4oggb1 are not available.

Timeline for d4oggb1:

Domains from same chain:
(mouse over for more information)
d4oggb2, d4oggb3
Domains from other chains:
(mouse over for more information)
d4ogga1, d4ogga2, d4oggc1, d4oggc2, d4oggc3