Lineage for d4of1a_ (4of1 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) 
contains insert beta-sheet subdomain and C-terminal helix
Family b.34.6.2: Kid/PemK [82075] (4 proteins)
automatically mapped to Pfam PF02452
Protein automated matches [228538] (6 species)
not a true protein
Species Staphylococcus aureus [TaxId:158878] [268507] (1 PDB entry) 
Domain d4of1a_: 4of1 A: [268508]
automated match to d4mzpa_
Details for d4of1a_
PDB Entry: 4of1 (more details), 2.45 Å
PDB Description: crystal structure of toxin from staphylococcus aureus Mu50
PDB Compounds: (A:) mRNA interferase MazFSCOPe Domain Sequences for d4of1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4of1a_ b.34.6.2 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglnav
SCOPe Domain Coordinates for d4of1a_:
Click to download the PDB-style file with coordinates for d4of1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4of1a_:
- d4of1a_ first appeared in SCOPe 2.05
- d4of1a_ appears in SCOPe 2.07
View in 3D
