Lineage for d4odxh_ (4odx H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759331Domain d4odxh_: 4odx H: [260200]
    Other proteins in same PDB: d4odxx_, d4odxy_
    automated match to d2p49b_

Details for d4odxh_

PDB Entry: 4odx (more details), 3.1 Å

PDB Description: 4E10 germline encoded precursor no.7 in complex with epitope scaffold T117
PDB Compounds: (H:) GEP7 Fv heavy chain

SCOPe Domain Sequences for d4odxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4odxh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafqhwgqg
tlvtvss

SCOPe Domain Coordinates for d4odxh_:

Click to download the PDB-style file with coordinates for d4odxh_.
(The format of our PDB-style files is described here.)

Timeline for d4odxh_: