Lineage for d4ocrl2 (4ocr L:106A-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1762953Domain d4ocrl2: 4ocr L:106A-212 [267027]
    Other proteins in same PDB: d4ocrl1
    automated match to d8faba2

Details for d4ocrl2

PDB Entry: 4ocr (more details), 1.9 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.01, a potent V1V2-directed HIV-1 neutralizing antibody
PDB Compounds: (L:) CAP256-VRC26.01 light chain

SCOPe Domain Sequences for d4ocrl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocrl2 b.1.1.2 (L:106A-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d4ocrl2:

Click to download the PDB-style file with coordinates for d4ocrl2.
(The format of our PDB-style files is described here.)

Timeline for d4ocrl2:

1762953
d4ocrl2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ocrl1