Lineage for d4o9ga_ (4o9g A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topologySuperfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.0: automated matches [191354] (1 protein)
not a true familyProtein automated matches [190388] (20 species)
not a true protein
Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (3 PDB entries) 
Domain d4o9ga_: 4o9g A: [238468]
automated match to d2paea1
complexed with 4td, edo, t46; mutant
Details for d4o9ga_
PDB Entry: 4o9g (more details), 1.9 Å
PDB Description: Crystal structure of the H51N mutant of the 3,4-ketoisomerase QdtA from Thermoanaerobacterium thermosaccharolyticum in complex with TDP-4-keto-6-deoxyglucose
PDB Compounds: (A:) QdtASCOPe Domain Sequences for d4o9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o9ga_ b.82.1.0 (A:) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgynshkklhqvl
iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
yirnydfyideakkrfle
SCOPe Domain Coordinates for d4o9ga_:
Click to download the PDB-style file with coordinates for d4o9ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4o9ga_:
- d4o9ga_ first appeared in SCOPe 2.03
- d4o9ga_ appears in SCOPe 2.04
- d4o9ga_ is called d4o9ga1 in SCOPe 2.06
- d4o9ga_ appears in the current release, SCOPe 2.08, called d4o9ga1
View in 3D
