Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (10 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [225479] (17 PDB entries) |
Domain d4o95a1: 4o95 A:38-246 [270986] Other proteins in same PDB: d4o95a2 automated match to d1w1oa2 complexed with 245, dms, edo, fad, gol, peg |
PDB Entry: 4o95 (more details), 1.75 Å
SCOPe Domain Sequences for d4o95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o95a1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]} vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg hghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwt lshgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcset enpdlffgvlgglgqfgiitrarialera
Timeline for d4o95a1: