Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255788] (10 PDB entries) |
Domain d4o7da_: 4o7d A: [257235] automated match to d3czda_ complexed with onl |
PDB Entry: 4o7d (more details), 2.3 Å
SCOPe Domain Sequences for d4o7da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o7da_ e.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smipdfmsftshidelyesakkqsggkvadyipqlakfspdlwgvsvctvdgqrhstgdt kvpfclqscvkplkyaiavndlgteyvhryvgkepsglrfnklflneddkphnpmvnaga ivvtslikqgvnnaekfdyvmqflnkmagneyvgfsnatfqseresgdrnfaigyylkek kcfpegtdmvgildfyfqlcsievtcesasvmaatlanggfcpitgervlspeavrntls lmhscgmydfsgqfafhvglpaksgvaggillvvpnvmgmmcwsppldkmgnsvkgihfc hdlvslcnfhnyd
Timeline for d4o7da_: