Lineage for d4o6wa2 (4o6w A:501-594)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.223: Polo-box domain [82614] (1 superfamily)
beta(6)-alpha; antiparallel beta-sheet, meanderSuperfamily d.223.1: Polo-box domain [82615] (3 families) 
Serine/threonine protein kinase-associated motif embedded in two distinct foldsFamily d.223.1.2: Polo-box duplicated region [102856] (1 protein)
duplication: consists of two polo-box domains; binds phosphothreonine peptideProtein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) Species Human (Homo sapiens) [TaxId:9606] [102858] (23 PDB entries) 
Domain d4o6wa2: 4o6w A:501-594 [261362]
automated match to d3hika2
Details for d4o6wa2
PDB Entry: 4o6w (more details), 1.45 Å
PDB Description: Peptide-Based Inhibitors of Plk1 Polo-box Domain
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1SCOPe Domain Sequences for d4o6wa2:
Sequence, based on SEQRES records: (download)
>d4o6wa2 d.223.1.2 (A:501-594) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr
tyrlslleeygcckelasrlryartmvdkllssr
Sequence, based on observed residues (ATOM records): (download)
>d4o6wa2 d.223.1.2 (A:501-594) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
erlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrls
lleeygcckelasrlryartmvdkllssr
SCOPe Domain Coordinates for d4o6wa2:
Click to download the PDB-style file with coordinates for d4o6wa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4o6wa2:
- d4o6wa2 first appeared in SCOPe 2.04
- d4o6wa2 appears in SCOPe 2.05
- d4o6wa2 appears in SCOPe 2.07
- d4o6wa2 appears in the current release, SCOPe 2.08
View in 3D
