Lineage for d4o0rb_ (4o0r B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d4o0rb_: 4o0r B: [236941]
    automated match to d2c30a_
    complexed with 7kc

Details for d4o0rb_

PDB Entry: 4o0r (more details), 2.4 Å

PDB Description: back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
PDB Compounds: (B:) Serine/threonine-protein kinase PAK 1

SCOPe Domain Sequences for d4o0rb_:

Sequence, based on SEQRES records: (download)

>d4o0rb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevaikqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrniksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrclemdvekrgsakellqhqflkiakplssltpliaaakeatk

Sequence, based on observed residues (ATOM records): (download)

>d4o0rb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevaikqmnlqkeli
ineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcre
clqaleflhsnqvihrniksdnillgmdgsvkltdfgqskrsemvgtpywmapevvtrka
ygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdflnr
clemdvekrgsakellqhqflkiakplssltpliaaakeatk

SCOPe Domain Coordinates for d4o0rb_ are not available.

Timeline for d4o0rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4o0ra_