Lineage for d4nxjb_ (4nxj B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.0: automated matches [191428] (1 protein)
not a true familyProtein automated matches [190615] (7 species)
not a true protein
Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries) 
Domain d4nxjb_: 4nxj B: [237858]
automated match to d3p1fa_
Details for d4nxjb_
PDB Entry: 4nxj (more details), 2.18 Å
PDB Description: crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum
PDB Compounds: (B:) Bromodomain proteinSCOPe Domain Sequences for d4nxjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nxjb_ a.29.2.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni
SCOPe Domain Coordinates for d4nxjb_:
Click to download the PDB-style file with coordinates for d4nxjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nxjb_:
- d4nxjb_ first appeared in SCOPe 2.03
- d4nxjb_ appears in SCOPe 2.04
- d4nxjb_ is called d4nxjb1 in SCOPe 2.06
- d4nxjb_ appears in the current release, SCOPe 2.08, called d4nxjb1
View in 3D
