Lineage for d4nv0a_ (4nv0 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.0: automated matches [191369] (1 protein)
not a true familyProtein automated matches [190447] (55 species)
not a true protein
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [237855] (2 PDB entries) 
Domain d4nv0a_: 4nv0 A: [237856]
automated match to d2g09a_
complexed with mg, mg7, mgf, pge
Details for d4nv0a_
PDB Entry: 4nv0 (more details), 1.65 Å
PDB Description: Crystal structure of cytosolic 5'-nucleotidase IIIB (cN-IIIB) bound to 7-methylguanosine
PDB Compounds: (A:) 7-methylguanosine phosphate-specific 5'-nucleotidaseSCOPe Domain Sequences for d4nv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nv0a_ c.108.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdytitkqrtedggavp
ssfgifnacqslpenfkaetdklyhkyrpieidphmpiaekvqymiewwtksgeltsgfp
fdqseidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvsvlrqanvlhpnv
kvvsnflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhiivmgdsigdadm
asgvpasshimkigflfdhveanmkkymdtfdivlvddqtmdvprtllsliekqhklnl
SCOPe Domain Coordinates for d4nv0a_:
Click to download the PDB-style file with coordinates for d4nv0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nv0a_:
- d4nv0a_ first appeared in SCOPe 2.03
- d4nv0a_ appears in SCOPe 2.06
- d4nv0a_ appears in the current release, SCOPe 2.08
View in 3D
