Lineage for d4nrba_ (4nrb A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731839Domain d4nrba_: 4nrb A: [230178]
    automated match to d3g0la_
    complexed with 2lx, edo

Details for d4nrba_

PDB Entry: 4nrb (more details), 2.08 Å

PDB Description: Crystal Structure of the bromodomain of human BAZ2B in complex with compound-1 N01197
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4nrba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrba_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf

SCOPe Domain Coordinates for d4nrba_:

Click to download the PDB-style file with coordinates for d4nrba_.
(The format of our PDB-style files is described here.)

Timeline for d4nrba_: