Lineage for d4npda_ (4npd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2697064Protein automated matches [191290] (5 species)
    not a true protein
  7. 2697072Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries)
  8. 2697073Domain d4npda_: 4npd A: [260512]
    automated match to d1bdca_
    complexed with scn, zn

Details for d4npda_

PDB Entry: 4npd (more details), 0.9 Å

PDB Description: high-resolution structure of c domain of staphylococcal protein a at cryogenic temperature
PDB Compounds: (A:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4npda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npda_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
adnkfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk

SCOPe Domain Coordinates for d4npda_:

Click to download the PDB-style file with coordinates for d4npda_.
(The format of our PDB-style files is described here.)

Timeline for d4npda_: