Lineage for d4npca_ (4npc A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (309 species)
not a true protein
Species Brucella suis [TaxId:470137] [229017] (4 PDB entries) 
Domain d4npca_: 4npc A: [229728]
automated match to d1fmca_
complexed with act
Details for d4npca_
PDB Entry: 4npc (more details), 1.75 Å
PDB Description: crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis
PDB Compounds: (A:) sorbitol dehydrogenaseSCOPe Domain Sequences for d4npca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4npca_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]}
qidlnfplsekvaivtggasgigaaiskafiakgakvavldisadiakakaeelgenakp
fvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisldywdktininlkgsf
lvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvigmsktfaaewgkygi
cvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaavflasagadmitga
dllidggytil
SCOPe Domain Coordinates for d4npca_:
Click to download the PDB-style file with coordinates for d4npca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4npca_:
- d4npca_ first appeared in SCOPe 2.03
- d4npca_ appears in SCOPe 2.06
- d4npca_ appears in the current release, SCOPe 2.08
View in 3D
