Lineage for d4npca_ (4npc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107196Species Brucella suis [TaxId:470137] [229017] (3 PDB entries)
  8. 2107199Domain d4npca_: 4npc A: [229728]
    automated match to d1fmca_
    complexed with act

Details for d4npca_

PDB Entry: 4npc (more details), 1.75 Å

PDB Description: crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis
PDB Compounds: (A:) sorbitol dehydrogenase

SCOPe Domain Sequences for d4npca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npca_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]}
qidlnfplsekvaivtggasgigaaiskafiakgakvavldisadiakakaeelgenakp
fvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisldywdktininlkgsf
lvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvigmsktfaaewgkygi
cvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaavflasagadmitga
dllidggytil

SCOPe Domain Coordinates for d4npca_:

Click to download the PDB-style file with coordinates for d4npca_.
(The format of our PDB-style files is described here.)

Timeline for d4npca_: