Lineage for d4npbb1 (4npb B:22-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936239Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2936272Family d.17.3.0: automated matches [228319] (1 protein)
    not a true family
  6. 2936273Protein automated matches [228320] (3 species)
    not a true protein
  7. 2936284Species Yersinia pestis [TaxId:214092] [230167] (1 PDB entry)
  8. 2936286Domain d4npbb1: 4npb B:22-81 [230168]
    Other proteins in same PDB: d4npba2, d4npba3, d4npbb2, d4npbb3
    automated match to d1eeja2
    complexed with po4

Details for d4npbb1

PDB Entry: 4npb (more details), 2.15 Å

PDB Description: the crystal structure of thiol:disulfide interchange protein dsbc from yersinia pestis co92
PDB Compounds: (B:) Protein disulfide isomerase II

SCOPe Domain Sequences for d4npbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npbb1 d.17.3.0 (B:22-81) automated matches {Yersinia pestis [TaxId: 214092]}
ddsaiqqtlkkldiqqadiqpspipgistvmtesgvlyisadgkhllqgplydvsgdqpi

SCOPe Domain Coordinates for d4npbb1:

Click to download the PDB-style file with coordinates for d4npbb1.
(The format of our PDB-style files is described here.)

Timeline for d4npbb1: