Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (5 PDB entries) |
Domain d4nnjb_: 4nnj B: [257173] automated match to d3dbhi_ complexed with amp, gol, so4 |
PDB Entry: 4nnj (more details), 2.4 Å
SCOPe Domain Sequences for d4nnjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnjb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} aamqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsd yniqkestlhlvlrlrgg
Timeline for d4nnjb_: