Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.6: HR1 repeat [46585] (1 family) |
Family a.2.6.1: HR1 repeat [46586] (2 proteins) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
Protein automated matches [229723] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [229724] (1 PDB entry) |
Domain d4nkgb_: 4nkg B: [229725] automated match to d1urfa_ complexed with hez |
PDB Entry: 4nkg (more details), 2.9 Å
SCOPe Domain Sequences for d4nkgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nkgb_ a.2.6.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiirmql rralqa
Timeline for d4nkgb_: