![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (25 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries) |
![]() | Domain d4nhjb_: 4nhj B: [257990] automated match to d3zq7a_ protein/DNA complex |
PDB Entry: 4nhj (more details), 2.7 Å
SCOPe Domain Sequences for d4nhjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhjb_ a.4.6.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} hktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqimdrdallknlrgvty dgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaph
Timeline for d4nhjb_: