Lineage for d4nhdb_ (4nhd B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393168Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)
  8. 1393178Domain d4nhdb_: 4nhd B: [230159]
    automated match to d4dfea_
    complexed with ca, coa, na

Details for d4nhdb_

PDB Entry: 4nhd (more details), 1.78 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii (fabh) from vibrio cholerae in complex with coenzyme a
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

SCOPe Domain Sequences for d4nhdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhdb_ c.95.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
amyskilgtgsylpsqvrtnadlekmvetsdewivartgirerriaadnetvadmaffaa
qnainmagidkhdidmiivattsashtfpsaacqvqgklgikgcpafdlaaacsgfmyal
siadqhvksgmckhvlvigadalsktcdptdrstiilfgdgagavvvgasnepgilsthi
hadgefgdllslevpvrggdsdkwlhmagnevfkvavtqlsklvvdtlkannmhkseldw
lvphqanyriisatakklsmsldqvvitldrhgntsaatvptaldeavrdgriqrgqmll
leafgggftwgsalvkf

SCOPe Domain Coordinates for d4nhdb_:

Click to download the PDB-style file with coordinates for d4nhdb_.
(The format of our PDB-style files is described here.)

Timeline for d4nhdb_:

  • d4nhdb_ is new in SCOPe 2.03-stable
  • d4nhdb_ does not appear in SCOPe 2.04