Lineage for d4ne4a_ (4ne4 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163445Species Agrobacterium fabrum [TaxId:176299] [258501] (11 PDB entries)
  8. 2163452Domain d4ne4a_: 4ne4 A: [266911]
    automated match to d3ppra_
    complexed with btb, cl

Details for d4ne4a_

PDB Entry: 4ne4 (more details), 1.73 Å

PDB Description: crystal structure of abc transporter substrate binding protein prox from agrobacterium tumefaciens cocrystalized with btb
PDB Compounds: (A:) ABC transporter, substrate binding protein (Proline/glycine/betaine)

SCOPe Domain Sequences for d4ne4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ne4a_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
aqvvvsskidteggvlgniilavlnqnkiettdriqlgatpvvrkaitageidiypeytg
naafffskaddplwkdaakgyeeaktldydankivwlapspanntwaialrkdvadknnl
ktlsdfgkyvagggtvvlaassefvnsaaalpafqttygftmkpdqlitlsggdtaatia
aaanqtnnanaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkhpnieell
kpvfekldlatlqdlnarvqvggeqaktvamdfltkngfak

SCOPe Domain Coordinates for d4ne4a_:

Click to download the PDB-style file with coordinates for d4ne4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ne4a_: