Lineage for d4ndne_ (4ndn E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847211Domain d4ndne_: 4ndn E: [257987]
    Other proteins in same PDB: d4ndna1, d4ndna2, d4ndna3, d4ndnb1, d4ndnb2, d4ndnb3, d4ndnc1, d4ndnc2, d4ndnc3, d4ndnd1, d4ndnd2, d4ndnd3
    automated match to d3sc6a_
    complexed with edo, mg, ppk, sam

Details for d4ndne_

PDB Entry: 4ndn (more details), 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp
PDB Compounds: (E:) methionine adenosyltransferase 2 subunit beta

SCOPe Domain Sequences for d4ndne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndne_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdf
qphvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnp
pyreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvq
fsnksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacai
adafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflid
krwrqtvfh

SCOPe Domain Coordinates for d4ndne_:

Click to download the PDB-style file with coordinates for d4ndne_.
(The format of our PDB-style files is described here.)

Timeline for d4ndne_: