Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d4ndne_: 4ndn E: [257987] Other proteins in same PDB: d4ndna1, d4ndna2, d4ndna3, d4ndnb1, d4ndnb2, d4ndnb3, d4ndnc1, d4ndnc2, d4ndnc3, d4ndnd1, d4ndnd2, d4ndnd3 automated match to d3sc6a_ complexed with edo, mg, ppk, sam |
PDB Entry: 4ndn (more details), 2.34 Å
SCOPe Domain Sequences for d4ndne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ndne_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdf qphvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnp pyreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvq fsnksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacai adafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflid krwrqtvfh
Timeline for d4ndne_: