Lineage for d4ndaa_ (4nda A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841582Protein automated matches [190581] (8 species)
    not a true protein
  7. 1841601Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (8 PDB entries)
  8. 1841602Domain d4ndaa_: 4nda A: [237843]
    automated match to d1j1ua_
    complexed with gol, na, niy

Details for d4ndaa_

PDB Entry: 4nda (more details), 1.7 Å

PDB Description: crystal structure of 3-nitro-tyrosine trna synthetase (5b) bound to 3- nitro-tyrosine
PDB Compounds: (A:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d4ndaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndaa_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
diiilladlcaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsahyrgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrlle

SCOPe Domain Coordinates for d4ndaa_:

Click to download the PDB-style file with coordinates for d4ndaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ndaa_: