Lineage for d4nb1a_ (4nb1 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (18 species)
not a true proteinSpecies Staphylococcus aureus [TaxId:158879] [237200] (5 PDB entries) 
Domain d4nb1a_: 4nb1 A: [237203]
automated match to d4jh2a_
complexed with cys, so4
Details for d4nb1a_
PDB Entry: 4nb1 (more details), 1.8 Å
PDB Description: Crystal Structure of FosB from Staphylococcus aureus at 1.80 Angstrom Resolution with L-Cysteine-Cys9 Disulfide
PDB Compounds: (A:) Metallothiol transferase FosBSCOPe Domain Sequences for d4nb1a_:
Sequence, based on SEQRES records: (download)
>d4nb1a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
hmlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprne
ihfsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghklelhtg
tlenrlnyykeakphmtfyk
Sequence, based on observed residues (ATOM records): (download)
>d4nb1a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
hmlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneehfsythi
aftiddsefkywhqrlkdnnvnileqsiyftdpdghklelhtgtlenrlnyakphmtfyk
SCOPe Domain Coordinates for d4nb1a_:
Click to download the PDB-style file with coordinates for d4nb1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nb1a_:
- d4nb1a_ first appeared in SCOPe 2.03
- d4nb1a_ appears in SCOPe 2.04
- d4nb1a_ is called d4nb1a1 in SCOPe 2.06
- d4nb1a_ appears in the current release, SCOPe 2.08, called d4nb1a1
View in 3D
