Lineage for d4n8gb_ (4n8g B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880384Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries)
  8. 1880386Domain d4n8gb_: 4n8g B: [266890]
    automated match to d4mcoc_
    complexed with cl, dal, so4

Details for d4n8gb_

PDB Entry: 4n8g (more details), 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine
PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4n8gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8gb_ c.94.1.0 (B:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
attlnlsyngppdtdknavhlfasnlkrlveektdgdiqlklypnsmlgeeqermeqvin
tpslniasfaglspivpeiyvsaipflfedyeaahqffdegdywnkvedtleertgaell
gvieeggfldftnskrpisspedfeglrframdpsqvalyeafgasgtpipwtdtymalk
tnvadgqmnppmyiimgslyevqkyltlanvqysdqfliangewyddlseenrqaieaav
qeaselnredvekrvderiqfladqgmevieptedelaafrekgqpayiewltdeqgidr
awiemaledagqsdllanaen

SCOPe Domain Coordinates for d4n8gb_:

Click to download the PDB-style file with coordinates for d4n8gb_.
(The format of our PDB-style files is described here.)

Timeline for d4n8gb_: