Lineage for d4n8fa_ (4n8f A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2061135Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2061136Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 2061137Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 2061180Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries)
  8. 2061181Domain d4n8fa_: 4n8f A: [237666]
    automated match to d4jvzd_
    complexed with mg, so4

Details for d4n8fa_

PDB Entry: 4n8f (more details), 2 Å

PDB Description: CcmL from Thermosynechococcus elongatus BP-1
PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4n8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n8fa_ b.40.15.1 (A:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg
saarhiingtdkpidaavvaiidtvsrdnyllysk

SCOPe Domain Coordinates for d4n8fa_:

Click to download the PDB-style file with coordinates for d4n8fa_.
(The format of our PDB-style files is described here.)

Timeline for d4n8fa_: