Class b: All beta proteins [48724] (180 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein automated matches [226918] (3 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries) |
Domain d4n7lh2: 4n7l H:36-251 [236226] Other proteins in same PDB: d4n7lh1, d4n7ll_, d4n7lm_ automated match to d1ysth1 complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10 |
PDB Entry: 4n7l (more details), 2.85 Å
SCOPe Domain Sequences for d4n7lh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7lh2 b.41.1.1 (H:36-251) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksv
Timeline for d4n7lh2: